GRK6 monoclonal antibody (M06), clone 2G1
  • GRK6 monoclonal antibody (M06), clone 2G1

GRK6 monoclonal antibody (M06), clone 2G1

Ref: AB-H00002870-M06
GRK6 monoclonal antibody (M06), clone 2G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRK6.
Información adicional
Size 100 ug
Gene Name GRK6
Gene Alias FLJ32135|GPRK6
Gene Description G protein-coupled receptor kinase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRK6 (AAH17272, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2870
Clone Number 2G1
Iso type IgG1 Kappa

Enviar uma mensagem


GRK6 monoclonal antibody (M06), clone 2G1

GRK6 monoclonal antibody (M06), clone 2G1