GRK4 polyclonal antibody (A01)
  • GRK4 polyclonal antibody (A01)

GRK4 polyclonal antibody (A01)

Ref: AB-H00002868-A01
GRK4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRK4.
Información adicional
Size 50 uL
Gene Name GRK4
Gene Alias GPRK2L|GPRK4|GRK4a|IT11
Gene Description G protein-coupled receptor kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRK4 (NP_892027, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2868

Enviar uma mensagem


GRK4 polyclonal antibody (A01)

GRK4 polyclonal antibody (A01)