MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)
  • MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)

MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002847-D01P
MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MCHR1 protein.
Información adicional
Size 100 ug
Gene Name MCHR1
Gene Alias GPR24|MCH1R|MGC32129|SLC1
Gene Description melanin-concentrating hormone receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MCHR1 (AAH21146.1, 1 a.a. ~ 422 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2847

Enviar uma mensagem


MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)

MCHR1 purified MaxPab rabbit polyclonal antibody (D01P)