GP1BA purified MaxPab mouse polyclonal antibody (B01P)
  • GP1BA purified MaxPab mouse polyclonal antibody (B01P)

GP1BA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002811-B01P
GP1BA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GP1BA protein.
Información adicional
Size 50 ug
Gene Name GP1BA
Gene Alias BSS|CD42B|CD42b-alpha|GP1B|MGC34595
Gene Description glycoprotein Ib (platelet), alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GP1BA (AAH27955.1, 1 a.a. ~ 626 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2811

Enviar uma mensagem


GP1BA purified MaxPab mouse polyclonal antibody (B01P)

GP1BA purified MaxPab mouse polyclonal antibody (B01P)