GP1BA polyclonal antibody (A01)
  • GP1BA polyclonal antibody (A01)

GP1BA polyclonal antibody (A01)

Ref: AB-H00002811-A01
GP1BA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GP1BA.
Información adicional
Size 50 uL
Gene Name GP1BA
Gene Alias BSS|CD42B|CD42b-alpha|GP1B|MGC34595
Gene Description glycoprotein Ib (platelet), alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVPFNRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GP1BA (AAH27955, 19 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2811

Enviar uma mensagem


GP1BA polyclonal antibody (A01)

GP1BA polyclonal antibody (A01)