SFN purified MaxPab rabbit polyclonal antibody (D01P)
  • SFN purified MaxPab rabbit polyclonal antibody (D01P)

SFN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002810-D01P
SFN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SFN protein.
Información adicional
Size 100 ug
Gene Name SFN
Gene Alias YWHAS
Gene Description stratifin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SFN (NP_006133.1, 1 a.a. ~ 248 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2810

Enviar uma mensagem


SFN purified MaxPab rabbit polyclonal antibody (D01P)

SFN purified MaxPab rabbit polyclonal antibody (D01P)