GOT2 monoclonal antibody (M09), clone 4H8
  • GOT2 monoclonal antibody (M09), clone 4H8

GOT2 monoclonal antibody (M09), clone 4H8

Ref: AB-H00002806-M09
GOT2 monoclonal antibody (M09), clone 4H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GOT2.
Información adicional
Size 100 ug
Gene Name GOT2
Gene Alias FLJ40994|KAT4|KATIV|mitAAT
Gene Description glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GOT2 (NP_002071, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2806
Clone Number 4H8
Iso type IgG2b Kappa

Enviar uma mensagem


GOT2 monoclonal antibody (M09), clone 4H8

GOT2 monoclonal antibody (M09), clone 4H8