GOLGA2 purified MaxPab mouse polyclonal antibody (B01P)
  • GOLGA2 purified MaxPab mouse polyclonal antibody (B01P)

GOLGA2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002801-B01P
GOLGA2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GOLGA2 protein.
Información adicional
Size 50 ug
Gene Name GOLGA2
Gene Alias GM130|MGC20672
Gene Description golgi autoantigen, golgin subfamily a, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IHC-P,IF
Immunogen Prot. Seq MQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGEGDGLDREEEEDEEEEEEAVAVPQPMPSIPEDLESREAMVAFFNSAVASAEEEQARLRGQLKEQSVRCRRLAHLLASAQKEPEAAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GOLGA2 (AAH06381.1, 1 a.a. ~ 345 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2801

Enviar uma mensagem


GOLGA2 purified MaxPab mouse polyclonal antibody (B01P)

GOLGA2 purified MaxPab mouse polyclonal antibody (B01P)