View larger
Mouse monoclonal antibody raised against a partial recombinant GNRH1.
AB-H00002796-M11A
New product
GNRH1 monoclonal antibody (M11A), clone 1C2
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 200 uL |
| Gene Name | GNRH1 |
| Gene Alias | GNRH|GRH|LHRH|LNRH |
| Gene Description | gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | GNRH1 (NP_000816, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 2796 |
| Clone Number | 1C2 |
| Iso type | IgM Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant GNRH1.