GNG11 polyclonal antibody (A01)
  • GNG11 polyclonal antibody (A01)

GNG11 polyclonal antibody (A01)

Ref: AB-H00002791-A01
GNG11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant GNG11.
Información adicional
Size 50 uL
Gene Name GNG11
Gene Alias GNGT11
Gene Description guanine nucleotide binding protein (G protein), gamma 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNG11 (AAH09709, 1 a.a. ~ 73 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2791

Enviar uma mensagem


GNG11 polyclonal antibody (A01)

GNG11 polyclonal antibody (A01)