GNG3 polyclonal antibody (A01)
  • GNG3 polyclonal antibody (A01)

GNG3 polyclonal antibody (A01)

Ref: AB-H00002785-A01
GNG3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant GNG3.
Información adicional
Size 50 uL
Gene Name GNG3
Gene Alias -
Gene Description guanine nucleotide binding protein (G protein), gamma 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNG3 (AAH15563, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2785

Enviar uma mensagem


GNG3 polyclonal antibody (A01)

GNG3 polyclonal antibody (A01)