GNAZ purified MaxPab mouse polyclonal antibody (B01P)
  • GNAZ purified MaxPab mouse polyclonal antibody (B01P)

GNAZ purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002781-B01P
GNAZ purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GNAZ protein.
Información adicional
Size 50 ug
Gene Name GNAZ
Gene Alias -
Gene Description guanine nucleotide binding protein (G protein), alpha z polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEACKEYKPLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADQGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFDSIC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GNAZ (AAH26342, 1 a.a. ~ 355 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2781

Enviar uma mensagem


GNAZ purified MaxPab mouse polyclonal antibody (B01P)

GNAZ purified MaxPab mouse polyclonal antibody (B01P)