GNAL polyclonal antibody (A01)
  • GNAL polyclonal antibody (A01)

GNAL polyclonal antibody (A01)

Ref: AB-H00002774-A01
GNAL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GNAL.
Información adicional
Size 50 uL
Gene Name GNAL
Gene Alias -
Gene Description guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLKQYELL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNAL (NP_892023, 359 a.a. ~ 458 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2774

Enviar uma mensagem


GNAL polyclonal antibody (A01)

GNAL polyclonal antibody (A01)