GMPR monoclonal antibody (M01A), clone 3G12
  • GMPR monoclonal antibody (M01A), clone 3G12

GMPR monoclonal antibody (M01A), clone 3G12

Ref: AB-H00002766-M01A
GMPR monoclonal antibody (M01A), clone 3G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GMPR.
Información adicional
Size 200 uL
Gene Name GMPR
Gene Alias GMPR1
Gene Description guanosine monophosphate reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GMPR (NP_006868, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 2766
Clone Number 3G12
Iso type IgM Kappa

Enviar uma mensagem


GMPR monoclonal antibody (M01A), clone 3G12

GMPR monoclonal antibody (M01A), clone 3G12