GMPR purified MaxPab rabbit polyclonal antibody (D01P)
  • GMPR purified MaxPab rabbit polyclonal antibody (D01P)

GMPR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002766-D01P
GMPR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GMPR protein.
Información adicional
Size 100 ug
Gene Name GMPR
Gene Alias GMPR1
Gene Description guanosine monophosphate reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GMPR (NP_006868.2, 1 a.a. ~ 345 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2766

Enviar uma mensagem


GMPR purified MaxPab rabbit polyclonal antibody (D01P)

GMPR purified MaxPab rabbit polyclonal antibody (D01P)