GML monoclonal antibody (M02), clone 1E7
  • GML monoclonal antibody (M02), clone 1E7

GML monoclonal antibody (M02), clone 1E7

Ref: AB-H00002765-M02
GML monoclonal antibody (M02), clone 1E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GML.
Información adicional
Size 100 ug
Gene Name GML
Gene Alias LY6DL
Gene Description glycosylphosphatidylinositol anchored molecule like protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GML (NP_002057, 48 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2765
Clone Number 1E7
Iso type IgG1 Kappa

Enviar uma mensagem


GML monoclonal antibody (M02), clone 1E7

GML monoclonal antibody (M02), clone 1E7