GM2A monoclonal antibody (M02), clone 2C8
  • GM2A monoclonal antibody (M02), clone 2C8

GM2A monoclonal antibody (M02), clone 2C8

Ref: AB-H00002760-M02
GM2A monoclonal antibody (M02), clone 2C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GM2A.
Información adicional
Size 100 ug
Gene Name GM2A
Gene Alias SAP-3
Gene Description GM2 ganglioside activator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq WIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GM2A (NP_000396.2, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2760
Clone Number 2C8
Iso type IgG2b Kappa

Enviar uma mensagem


GM2A monoclonal antibody (M02), clone 2C8

GM2A monoclonal antibody (M02), clone 2C8