GM2A purified MaxPab mouse polyclonal antibody (B02P)
  • GM2A purified MaxPab mouse polyclonal antibody (B02P)

GM2A purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00002760-B02P
GM2A purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GM2A protein.
Información adicional
Size 50 ug
Gene Name GM2A
Gene Alias SAP-3
Gene Description GM2 ganglioside activator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GM2A (NP_000396.2, 1 a.a. ~ 193 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2760

Enviar uma mensagem


GM2A purified MaxPab mouse polyclonal antibody (B02P)

GM2A purified MaxPab mouse polyclonal antibody (B02P)