GLRA1 monoclonal antibody (M09), clone 4D6 View larger

Mouse monoclonal antibody raised against a partial recombinant GLRA1.

AB-H00002741-M09

New product

GLRA1 monoclonal antibody (M09), clone 4D6

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name GLRA1
Gene Alias MGC138878|MGC138879|STHE
Gene Description glycine receptor, alpha 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLRA1 (NP_000162, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2741
Clone Number 4D6
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant GLRA1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant GLRA1.

Mouse monoclonal antibody raised against a partial recombinant GLRA1.