GLRA1 monoclonal antibody (M03), clone 2B9
  • GLRA1 monoclonal antibody (M03), clone 2B9

GLRA1 monoclonal antibody (M03), clone 2B9

Ref: AB-H00002741-M03
GLRA1 monoclonal antibody (M03), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GLRA1.
Información adicional
Size 100 ug
Gene Name GLRA1
Gene Alias MGC138878|MGC138879|STHE
Gene Description glycine receptor, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLRA1 (NP_000162, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2741
Clone Number 2B9
Iso type IgG2a Kappa

Enviar uma mensagem


GLRA1 monoclonal antibody (M03), clone 2B9

GLRA1 monoclonal antibody (M03), clone 2B9