GLO1 monoclonal antibody (M01), clone 4C12
  • GLO1 monoclonal antibody (M01), clone 4C12

GLO1 monoclonal antibody (M01), clone 4C12

Ref: AB-H00002739-M01
GLO1 monoclonal antibody (M01), clone 4C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GLO1.
Información adicional
Size 100 ug
Gene Name GLO1
Gene Alias GLOD1|GLYI
Gene Description glyoxalase I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MAEPQPPSGGLTDEAALSYCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLO1 (AAH11365.1, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2739
Clone Number 4C12
Iso type IgG2b Kappa

Enviar uma mensagem


GLO1 monoclonal antibody (M01), clone 4C12

GLO1 monoclonal antibody (M01), clone 4C12