GLO1 MaxPab rabbit polyclonal antibody (D01)
  • GLO1 MaxPab rabbit polyclonal antibody (D01)

GLO1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002739-D01
GLO1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GLO1 protein.
Información adicional
Size 100 uL
Gene Name GLO1
Gene Alias GLOD1|GLYI
Gene Description glyoxalase I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDATQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GLO1 (AAH15934.1, 1 a.a. ~ 184 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2739

Enviar uma mensagem


GLO1 MaxPab rabbit polyclonal antibody (D01)

GLO1 MaxPab rabbit polyclonal antibody (D01)