GLB1 purified MaxPab mouse polyclonal antibody (B01P)
  • GLB1 purified MaxPab mouse polyclonal antibody (B01P)

GLB1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002720-B01P
GLB1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GLB1 protein.
Información adicional
Size 50 ug
Gene Name GLB1
Gene Alias EBP|ELNR1
Gene Description galactosidase, beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPGFLVRILLLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GLB1 (AAH07493.1, 1 a.a. ~ 677 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2720

Enviar uma mensagem


GLB1 purified MaxPab mouse polyclonal antibody (B01P)

GLB1 purified MaxPab mouse polyclonal antibody (B01P)