GK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • GK2 purified MaxPab rabbit polyclonal antibody (D01P)

GK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002712-D01P
GK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GK2 protein.
Información adicional
Size 100 ug
Gene Name GK2
Gene Alias GKP2|GKTA
Gene Description glycerol kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEILQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIYGLIKTGALEGVPISG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GK2 (NP_149991.2, 1 a.a. ~ 553 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2712

Enviar uma mensagem


GK2 purified MaxPab rabbit polyclonal antibody (D01P)

GK2 purified MaxPab rabbit polyclonal antibody (D01P)