GJA8 monoclonal antibody (M02), clone 8A10
  • GJA8 monoclonal antibody (M02), clone 8A10

GJA8 monoclonal antibody (M02), clone 8A10

Ref: AB-H00002703-M02
GJA8 monoclonal antibody (M02), clone 8A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GJA8.
Información adicional
Size 100 ug
Gene Name GJA8
Gene Alias CAE|CAE1|CX50|CZP1|MP70
Gene Description gap junction protein, alpha 8, 50kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GJA8 (NP_005258, 301 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2703
Clone Number 8A10
Iso type IgG2a Kappa

Enviar uma mensagem


GJA8 monoclonal antibody (M02), clone 8A10

GJA8 monoclonal antibody (M02), clone 8A10