GJA1 monoclonal antibody (M01), clone 3E5
  • GJA1 monoclonal antibody (M01), clone 3E5

GJA1 monoclonal antibody (M01), clone 3E5

Ref: AB-H00002697-M01
GJA1 monoclonal antibody (M01), clone 3E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GJA1.
Información adicional
Size 100 ug
Gene Name GJA1
Gene Alias CX43|DFNB38|GJAL|ODDD
Gene Description gap junction protein, alpha 1, 43kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq GSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GJA1 (AAH26329, 261 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2697
Clone Number 3E5
Iso type IgG1 Kappa

Enviar uma mensagem


GJA1 monoclonal antibody (M01), clone 3E5

GJA1 monoclonal antibody (M01), clone 3E5