GHR polyclonal antibody (A01)
  • GHR polyclonal antibody (A01)

GHR polyclonal antibody (A01)

Ref: AB-H00002690-A01
GHR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GHR.
Información adicional
Size 50 uL
Gene Name GHR
Gene Alias GHBP
Gene Description growth hormone receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GHR (NP_000154, 19 a.a. ~ 118 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2690

Enviar uma mensagem


GHR polyclonal antibody (A01)

GHR polyclonal antibody (A01)