GH2 monoclonal antibody (M02), clone 1D10
  • GH2 monoclonal antibody (M02), clone 1D10

GH2 monoclonal antibody (M02), clone 1D10

Ref: AB-H00002689-M02
GH2 monoclonal antibody (M02), clone 1D10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GH2.
Información adicional
Size 100 ug
Gene Name GH2
Gene Alias GH-V|GHL|GHV|hGH-V
Gene Description growth hormone 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Specificity This antibody cross-reacts with human GH1.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GH2 (AAH20760.1, 27 a.a. ~ 217 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2689
Clone Number 1D10
Iso type IgG1 Kappa

Enviar uma mensagem


GH2 monoclonal antibody (M02), clone 1D10

GH2 monoclonal antibody (M02), clone 1D10