GGTLA1 monoclonal antibody (M01A), clone 3E10
  • GGTLA1 monoclonal antibody (M01A), clone 3E10

GGTLA1 monoclonal antibody (M01A), clone 3E10

Ref: AB-H00002687-M01A
GGTLA1 monoclonal antibody (M01A), clone 3E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GGTLA1.
Información adicional
Size 200 uL
Gene Name GGT5
Gene Alias DKFZp566O011|FLJ92733|GGT-REL|GGTLA1
Gene Description gamma-glutamyltransferase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GGTLA1 (NP_004112.1, 510 a.a. ~ 586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 2687
Clone Number 3E10
Iso type IgM Kappa

Enviar uma mensagem


GGTLA1 monoclonal antibody (M01A), clone 3E10

GGTLA1 monoclonal antibody (M01A), clone 3E10