GGT1 monoclonal antibody (M01), clone 1F9
  • GGT1 monoclonal antibody (M01), clone 1F9

GGT1 monoclonal antibody (M01), clone 1F9

Ref: AB-H00002678-M01
GGT1 monoclonal antibody (M01), clone 1F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GGT1.
Información adicional
Size 100 ug
Gene Name GGT1
Gene Alias CD224|D22S672|D22S732|GGT|GTG|MGC96892|MGC96904|MGC96963
Gene Description gamma-glutamyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,IP,S-ELISA,ELISA
Immunogen Prot. Seq TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GGT1 (NP_005256, 381 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2678
Clone Number 1F9
Iso type IgG2a Kappa

Enviar uma mensagem


GGT1 monoclonal antibody (M01), clone 1F9

GGT1 monoclonal antibody (M01), clone 1F9