GGT1 purified MaxPab mouse polyclonal antibody (B01P)
  • GGT1 purified MaxPab mouse polyclonal antibody (B01P)

GGT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002678-B01P
GGT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GGT1 protein.
Información adicional
Size 50 ug
Gene Name GGT1
Gene Alias CD224|D22S672|D22S732|GGT|GTG|MGC96892|MGC96904|MGC96963
Gene Description gamma-glutamyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GGT1 (NP_005256.2, 1 a.a. ~ 569 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2678

Enviar uma mensagem


GGT1 purified MaxPab mouse polyclonal antibody (B01P)

GGT1 purified MaxPab mouse polyclonal antibody (B01P)