GFI1 monoclonal antibody (M01), clone 3G8
  • GFI1 monoclonal antibody (M01), clone 3G8

GFI1 monoclonal antibody (M01), clone 3G8

Ref: AB-H00002672-M01
GFI1 monoclonal antibody (M01), clone 3G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GFI1.
Información adicional
Size 100 ug
Gene Name GFI1
Gene Alias FLJ94509|GFI-1|ZNF163
Gene Description growth factor independent 1 transcription repressor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GFI1 (NP_005254, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2672
Clone Number 3G8
Iso type IgG1 Kappa

Enviar uma mensagem


GFI1 monoclonal antibody (M01), clone 3G8

GFI1 monoclonal antibody (M01), clone 3G8