GFI1 purified MaxPab mouse polyclonal antibody (B01P)
  • GFI1 purified MaxPab mouse polyclonal antibody (B01P)

GFI1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002672-B01P
GFI1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GFI1 protein.
Información adicional
Size 50 ug
Gene Name GFI1
Gene Alias FLJ94509|GFI-1|ZNF163
Gene Description growth factor independent 1 transcription repressor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GFI1 (ABM85387.1, 1 a.a. ~ 422 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2672

Enviar uma mensagem


GFI1 purified MaxPab mouse polyclonal antibody (B01P)

GFI1 purified MaxPab mouse polyclonal antibody (B01P)