GFI1 polyclonal antibody (A01)
  • GFI1 polyclonal antibody (A01)

GFI1 polyclonal antibody (A01)

Ref: AB-H00002672-A01
GFI1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GFI1.
Información adicional
Size 50 uL
Gene Name GFI1
Gene Alias FLJ94509|GFI-1|ZNF163
Gene Description growth factor independent 1 transcription repressor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GFI1 (NP_005254, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2672

Enviar uma mensagem


GFI1 polyclonal antibody (A01)

GFI1 polyclonal antibody (A01)