GFAP polyclonal antibody (A01)
  • GFAP polyclonal antibody (A01)

GFAP polyclonal antibody (A01)

Ref: AB-H00002670-A01
GFAP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GFAP.
Información adicional
Size 50 uL
Gene Name GFAP
Gene Alias FLJ45472
Gene Description glial fibrillary acidic protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GFAP (AAH41765, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2670

Enviar uma mensagem


GFAP polyclonal antibody (A01)

GFAP polyclonal antibody (A01)