GDNF purified MaxPab rabbit polyclonal antibody (D01P)
  • GDNF purified MaxPab rabbit polyclonal antibody (D01P)

GDNF purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002668-D01P
GDNF purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GDNF protein.
Información adicional
Size 100 ug
Gene Name GDNF
Gene Alias ATF1|ATF2|HFB1-GDNF
Gene Description glial cell derived neurotrophic factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GDNF (NP_000505.1, 1 a.a. ~ 211 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2668

Enviar uma mensagem


GDNF purified MaxPab rabbit polyclonal antibody (D01P)

GDNF purified MaxPab rabbit polyclonal antibody (D01P)