GCSH monoclonal antibody (M01), clone 3D8-A12
  • GCSH monoclonal antibody (M01), clone 3D8-A12

GCSH monoclonal antibody (M01), clone 3D8-A12

Ref: AB-H00002653-M01
GCSH monoclonal antibody (M01), clone 3D8-A12

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GCSH.
Información adicional
Size 100 ug
Gene Name GCSH
Gene Alias GCE|NKH
Gene Description glycine cleavage system protein H (aminomethyl carrier)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GCSH (AAH00790.1, 1 a.a. ~ 173 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2653
Clone Number 3D8-A12
Iso type IgG1 kappa

Enviar uma mensagem


GCSH monoclonal antibody (M01), clone 3D8-A12

GCSH monoclonal antibody (M01), clone 3D8-A12