GCHFR monoclonal antibody (M01), clone 4G6
  • GCHFR monoclonal antibody (M01), clone 4G6

GCHFR monoclonal antibody (M01), clone 4G6

Ref: AB-H00002644-M01
GCHFR monoclonal antibody (M01), clone 4G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GCHFR.
Información adicional
Size 100 ug
Gene Name GCHFR
Gene Alias GFRP|HsT16933|MGC138467|MGC138469|P35
Gene Description GTP cyclohydrolase I feedback regulator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2644
Clone Number 4G6
Iso type IgG2b Kappa

Enviar uma mensagem


GCHFR monoclonal antibody (M01), clone 4G6

GCHFR monoclonal antibody (M01), clone 4G6