GCG purified MaxPab rabbit polyclonal antibody (D01P)
  • GCG purified MaxPab rabbit polyclonal antibody (D01P)

GCG purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002641-D01P
GCG purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GCG protein.
Información adicional
Size 100 ug
Gene Name GCG
Gene Alias GLP1|GLP2|GRPP
Gene Description glucagon
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GCG (NP_002045.1, 1 a.a. ~ 180 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2641

Enviar uma mensagem


GCG purified MaxPab rabbit polyclonal antibody (D01P)

GCG purified MaxPab rabbit polyclonal antibody (D01P)