GCG polyclonal antibody (A01)
  • GCG polyclonal antibody (A01)

GCG polyclonal antibody (A01)

Ref: AB-H00002641-A01
GCG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant GCG.
Información adicional
Size 50 uL
Gene Name GCG
Gene Alias GLP1|GLP2|GRPP
Gene Description glucagon
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GCG (AAH05278, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2641

Enviar uma mensagem


GCG polyclonal antibody (A01)

GCG polyclonal antibody (A01)