GBX2 monoclonal antibody (M03), clone 1A7
  • GBX2 monoclonal antibody (M03), clone 1A7

GBX2 monoclonal antibody (M03), clone 1A7

Ref: AB-H00002637-M03
GBX2 monoclonal antibody (M03), clone 1A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GBX2.
Información adicional
Size 100 ug
Gene Name GBX2
Gene Alias -
Gene Description gastrulation brain homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GBX2 (NP_001476, 114 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2637
Clone Number 1A7
Iso type IgG2b Kappa

Enviar uma mensagem


GBX2 monoclonal antibody (M03), clone 1A7

GBX2 monoclonal antibody (M03), clone 1A7