GBP2 purified MaxPab mouse polyclonal antibody (B01P)
  • GBP2 purified MaxPab mouse polyclonal antibody (B01P)

GBP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002634-B01P
GBP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GBP2 protein.
Información adicional
Size 50 ug
Gene Name GBP2
Gene Alias -
Gene Description guanylate binding protein 2, interferon-inducible
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKKNGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GBP2 (AAH73163, 1 a.a. ~ 591 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2634

Enviar uma mensagem


GBP2 purified MaxPab mouse polyclonal antibody (B01P)

GBP2 purified MaxPab mouse polyclonal antibody (B01P)