GBA monoclonal antibody (M01), clone 2E2
  • GBA monoclonal antibody (M01), clone 2E2

GBA monoclonal antibody (M01), clone 2E2

Ref: AB-H00002629-M01
GBA monoclonal antibody (M01), clone 2E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GBA.
Información adicional
Size 100 ug
Gene Name GBA
Gene Alias GBA1|GCB|GLUC
Gene Description glucosidase, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GBA (NP_000148, 146 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2629
Clone Number 2E2
Iso type IgG2a Kappa

Enviar uma mensagem


GBA monoclonal antibody (M01), clone 2E2

GBA monoclonal antibody (M01), clone 2E2