GBA purified MaxPab mouse polyclonal antibody (B01P)
  • GBA purified MaxPab mouse polyclonal antibody (B01P)

GBA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002629-B01P
GBA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GBA protein.
Información adicional
Size 50 ug
Gene Name GBA
Gene Alias GBA1|GCB|GLUC
Gene Description glucosidase, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MEFSSPSREECPKPLSRVSIMAGSLTGLLLLQAVSWASGARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWARYFVKF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GBA (AAH03356.1, 1 a.a. ~ 536 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2629

Enviar uma mensagem


GBA purified MaxPab mouse polyclonal antibody (B01P)

GBA purified MaxPab mouse polyclonal antibody (B01P)