GBA polyclonal antibody (A01)
  • GBA polyclonal antibody (A01)

GBA polyclonal antibody (A01)

Ref: AB-H00002629-A01
GBA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GBA.
Información adicional
Size 50 uL
Gene Name GBA
Gene Alias GBA1|GCB|GLUC
Gene Description glucosidase, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GBA (NP_000148, 146 a.a. ~ 235 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2629

Enviar uma mensagem


GBA polyclonal antibody (A01)

GBA polyclonal antibody (A01)