GATA4 monoclonal antibody (M01), clone 6C6
  • GATA4 monoclonal antibody (M01), clone 6C6

GATA4 monoclonal antibody (M01), clone 6C6

Ref: AB-H00002626-M01
GATA4 monoclonal antibody (M01), clone 6C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GATA4.
Información adicional
Size 100 ug
Gene Name GATA4
Gene Alias MGC126629
Gene Description GATA binding protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GATA4 (NP_002043.2, 343 a.a. ~ 442 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2626
Clone Number 6C6
Iso type IgG2a Kappa

Enviar uma mensagem


GATA4 monoclonal antibody (M01), clone 6C6

GATA4 monoclonal antibody (M01), clone 6C6