GATA3 monoclonal antibody (M02), clone 2H5
  • GATA3 monoclonal antibody (M02), clone 2H5

GATA3 monoclonal antibody (M02), clone 2H5

Ref: AB-H00002625-M02
GATA3 monoclonal antibody (M02), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GATA3.
Información adicional
Size 100 ug
Gene Name GATA3
Gene Alias HDR|MGC2346|MGC5199|MGC5445
Gene Description GATA binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GATA3 (NP_001002295.1, 103 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2625
Clone Number 2H5
Iso type IgG2a Kappa

Enviar uma mensagem


GATA3 monoclonal antibody (M02), clone 2H5

GATA3 monoclonal antibody (M02), clone 2H5