GALT MaxPab rabbit polyclonal antibody (D01)
  • GALT MaxPab rabbit polyclonal antibody (D01)

GALT MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002592-D01
GALT MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GALT protein.
Información adicional
Size 100 uL
Gene Name GALT
Gene Alias -
Gene Description galactose-1-phosphate uridylyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MSRSGTDPQQRQQASEADAAAATFRANDHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGAIRANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAKSARGVCKVMCFHPWSDVTLPLMSVPEIRAVVDAWASVTEELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSFLPDIAQREERSQQAYKSQHGEPLLMEYSRQELLRKERLVLTSEHWLVLVPFWATWPYQTLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GALT (AAH15045.1, 1 a.a. ~ 379 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2592

Enviar uma mensagem


GALT MaxPab rabbit polyclonal antibody (D01)

GALT MaxPab rabbit polyclonal antibody (D01)