GALT purified MaxPab mouse polyclonal antibody (B01P)
  • GALT purified MaxPab mouse polyclonal antibody (B01P)

GALT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002592-B01P
GALT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GALT protein.
Información adicional
Size 50 ug
Gene Name GALT
Gene Alias -
Gene Description galactose-1-phosphate uridylyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSRSGTDPQQRQQASEADAAAATFRANDHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGAIRANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAKSARGVCKVMCFHPWSDVTLPLMSVPEIRAVVDAWASVTEELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSFLPDIAQREERSQQAYKSQHGEPLLMEYSRQELLRKERLVLTSEHWLVLVPFWATWPYQTLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GALT (AAH15045.1, 1 a.a. ~ 379 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2592

Enviar uma mensagem


GALT purified MaxPab mouse polyclonal antibody (B01P)

GALT purified MaxPab mouse polyclonal antibody (B01P)