GALNT2 polyclonal antibody (A01)
  • GALNT2 polyclonal antibody (A01)

GALNT2 polyclonal antibody (A01)

Ref: AB-H00002590-A01
GALNT2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GALNT2.
Información adicional
Size 50 uL
Gene Name GALNT2
Gene Alias GalNAc-T2
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GALNT2 (NP_004472, 473 a.a. ~ 571 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2590

Enviar uma mensagem


GALNT2 polyclonal antibody (A01)

GALNT2 polyclonal antibody (A01)